LL-37 Peptide Vials
Endogenous 37-residue antimicrobial peptide cleaved from the hCAP18 protein · 5mg · boxes of 10 vials
Free delivery worldwide on orders over $1,000 (about £749)
Strength 1 option · price per box
Boxes
5% off at 10+ boxes (any mix, bac water not counted) · 15+ boxes or a strength we don’t list? Ask for a bulk price: WhatsApp · Email
Order on WhatsApp insteadPrefer email? Order by email
- No minimumBoxes of 10 vials
- Tracked shippingDispatched in 1–2 working days
- Batch COAFree on request
- Photographed firstBefore it ships
Purity guarantee and free replacement within 14 days if anything arrives damaged or wrong. How it works
We accept
- Bank transfer
PayPal- Crypto
Often ordered together
One box of each. Change strengths or quantities in the cart.
About LL-37
What is LL-37?
Overview
What is LL-37?
LL-37 is the only cathelicidin antimicrobial peptide made in humans. It is cut from a larger protein, hCAP18, and takes its name from its first two residues (two leucines) and its length of 37 residues. Immune cells and the cells lining the skin, gut and airways make it, and it is studied both for killing microbes directly and for signalling to the immune system. Supplied as a lyophilised powder in sealed vials, boxed in tens, for laboratory research use only.
LL-37 at a glance
| Compound | LL-37 |
|---|---|
| Also known as | Cathelicidin LL-37, hCAP18, CAP18, CAMP, LL37, Antimicrobial peptide LL-37 |
| Classification | Endogenous 37-residue antimicrobial peptide cleaved from the hCAP18 protein |
| CAS number | 154947-66-7 |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493 g/mol |
| Sequence | [LL-37, 37 aa] |
| PubChem CID | 16198951 |
| Purity | 99%+ by HPLC |
| Physical form | Lyophilised powder |
| Available strengths | 5 mg |
| Box quantity | 10 vials |
| Price from | $9.00 per vial ($90.00 per box) |
| Research status | LL-37 has a large body of laboratory and animal research and some human tissue studies. It is a well-characterised research peptide rather than a clinical-stage drug. |
| Documentation | Batch-specific third-party COA |
These are catalogue target specifications, not batch results. The 99%+ purity figure is the specification we buy to. The authoritative figures for any particular box are the ones printed on that box’s Certificate of Analysis, which is lot-specific. What research grade actually means explains the difference. Terms such as HPLC purity and net peptide content are explained in the peptide glossary.
We make no “third-party verified” claim for a batch unless the matching report is supplied with it. Ask for the current COA for the lot in stock before you order — we will send it.
Prices for every strength
Pricing
LL-37 price per vial: 5mg
LL-37 starts at $9.00 per vial (£6.74), sold in boxes of 10 at $90.00. One box is the smallest order and there is no trade account or minimum spend. Larger volumes are negotiable.
| Strength | Per vial | Box of 10 |
|---|---|---|
| 5 mg | $9.00 £6.74 | $90.00 £67.43 |
Storage & reconstitution
Handling
How should LL-37 be stored and reconstituted?
Sealed vials tolerate ambient temperature in transit and keep at −20 °C beyond that. Reconstitute slowly down the vial wall, swirl rather than shake, then refrigerate at 2–8 °C and aliquot before freezing.
Why each of those matters, and what a freeze–thaw cycle actually costs: peptide handling and storage reference. How long a mixed vial keeps: reconstituted peptide shelf life.
What it is researched for
Research Context
What is LL-37 researched for?
Below is a plain-English summary of what published research has investigated, and what it has found. These are descriptions of research activity and published results. They are not claims about what LL-37 does, and nothing here is a statement that it is safe or effective for any purpose.
Wound healing research
In human skin, LL-37 rises during normal wound healing and is low in the epithelium of chronic ulcers. Blocking it impaired re-epithelialisation in a human skin wound model kept alive outside the body. 2
Antimicrobial and immune roles
LL-37 acts on bacterial membranes directly and also signals to immune cells, two roles that are studied separately. 1
What is not established
Its activity drops in some conditions, such as high salt or serum, and its effects can be pro- or anti-inflammatory depending on context. Neither question is settled.
References
- 1LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta (2006). PMID 16716248
- 2The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. J Invest Dermatol (2003). PMID 12603850
Links open the record on PubMed or PubMed Central. These are citations to published research, not claims about this product.
Laboratory uses
Applications
Where LL-37 is used in the laboratory
- Antimicrobial activity against bacteria and fungi in laboratory assays, including biofilm models
- Wound and skin research, where LL-37 rises during normal healing
- Innate immune signalling, since LL-37 also acts as a messenger to immune cells
- Membrane interaction studies, the mechanism behind its direct antimicrobial action
Batch COA
Verification
Does LL-37 come with a COA?
Yes — every box. Each batch of LL-37 is analysed by an independent third-party laboratory, and the certificate is tied to the batch number on the vial label.
Example COA. You receive the certificate matching your own batch.
Questions & answers
Questions
LL-37 questions, answered
What is LL-37 peptide?
LL-37 is a natural human peptide, part of the body's first-line defence against infection. White blood cells and the cells lining the skin, gut and airways make it. The research material is synthetic, with the same 37-residue sequence.
Is LL-37 approved?
No. LL-37 is not approved as a medicine in any country; it is a research compound. Not for human consumption.
How much does LL-37 cost?
LL-37 starts at $9.00 per vial, sold in boxes of 10 vials at $90.00 per box (about £67.43). 1 strength available: 5 mg. There is no minimum order.
Can I buy LL-37 5mg vials in the UK?
Yes. LL-37 5mg comes in boxes of 10 vials at $90.00 per box ($9.00 per vial, about £67.43 per box), sent tracked to UK addresses. There is no minimum order.
How is LL-37 shipped to the UK and USA?
Tracked to the UK, USA, EU and worldwide, in plain packaging, dispatched within 1–2 working days. Country-by-country estimates are on the shipping page.
